Cart 17 Product Products 5 274,10 € (empty)
No products
To be determined Shipping
5 274,10 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 17 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 5 274,10 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 5 274,10 €
Data sheet of ABO monoclonal antibody (M08), clone 1B7
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
More info about ABO monoclonal antibody (M08), clone 1B7
| Brand: | Abnova |
| Reference: | H00000028-M08 |
| Product name: | ABO monoclonal antibody (M08), clone 1B7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ABO. |
| Clone: | 1B7 |
| Isotype: | IgG1 Kappa |
| Gene id: | 28 |
| Gene name: | ABO |
| Gene alias: | A3GALNT|A3GALT1|GTB|NAGAT |
| Gene description: | ABO blood group (transferase A, alpha 1-3-N-acetylgalactosaminyltransferase; transferase B, alpha 1-3-galactosyltransferase) |
| Genbank accession: | NM_020469 |
| Immunogen: | ABO (NP_065202.2, 273 a.a. ~ 354 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPKNHQAVRNP |
| Protein accession: | NP_065202.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (34.76 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | ABO monoclonal antibody (M08), clone 1B7. Western Blot analysis of ABO expression in A-431. |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |