Cart 17 Product Products 5 274,10 € (empty)
No products
To be determined Shipping
5 274,10 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 17 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 5 274,10 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 5 274,10 €
Data sheet of ABL2 monoclonal antibody (M08), clone 5C7
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
More info about ABL2 monoclonal antibody (M08), clone 5C7
| Brand: | Abnova |
| Reference: | H00000027-M08 |
| Product name: | ABL2 monoclonal antibody (M08), clone 5C7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ABL2. |
| Clone: | 5C7 |
| Isotype: | IgG3 Kappa |
| Gene id: | 27 |
| Gene name: | ABL2 |
| Gene alias: | ABLL|ARG|FLJ22224|FLJ31718|FLJ41441 |
| Gene description: | v-abl Abelson murine leukemia viral oncogene homolog 2 (arg, Abelson-related gene) |
| Genbank accession: | BC065912 |
| Immunogen: | ABL2 (AAH65912, 743 a.a. ~ 842 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | KKTLGLRAGKPTASDDTSKPFPRSNSTSSMSSGLPEQDRMAMTLPRNCQRSKLQLERTVSTSSQPEENVDRANDMLPKKSEESAAPSRERPKAKLLPRGA |
| Protein accession: | AAH65912 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.41 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | ABL2 monoclonal antibody (M08), clone 5C7 Western Blot analysis of ABL2 expression in Jurkat ( Cat # L017V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |