Cart 18 Product Products 5 579,10 € (empty)
No products
To be determined Shipping
5 579,10 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 18 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 5 579,10 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 5 579,10 €
Data sheet of ABCA1 monoclonal antibody (M01A), clone 1H4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
More info about ABCA1 monoclonal antibody (M01A), clone 1H4
| Brand: | Abnova |
| Reference: | H00000019-M01A |
| Product name: | ABCA1 monoclonal antibody (M01A), clone 1H4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ABCA1. |
| Clone: | 1H4 |
| Isotype: | IgM Kappa |
| Gene id: | 19 |
| Gene name: | ABCA1 |
| Gene alias: | ABC-1|ABC1|CERP|FLJ14958|HDLDT1|MGC164864|MGC165011|TGD |
| Gene description: | ATP-binding cassette, sub-family A (ABC1), member 1 |
| Genbank accession: | NM_005502 |
| Immunogen: | ABCA1 (NP_005493, 86 a.a. ~ 185 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | TPGEAPGVVGNFNKSIVARLFSDARRLLLYSQKDTSMKDMRKVLRTLQQIKKSSSNLKLQDFLVDNETFSGFLYHNLSLPKSTVDKMLRADVILHKVFLQ |
| Protein accession: | NP_005493 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |