| Brand: | Abnova |
| Reference: | H00000013-M01 |
| Product name: | AADAC monoclonal antibody (M01), clone 2E8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant AADAC. |
| Clone: | 2E8 |
| Isotype: | IgG2b Kappa |
| Gene id: | 13 |
| Gene name: | AADAC |
| Gene alias: | CES5A1|DAC |
| Gene description: | arylacetamide deacetylase (esterase) |
| Genbank accession: | NM_001086 |
| Immunogen: | AADAC (NP_001077, 201 a.a. ~ 300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | QLLDDPDVKIKLKIQSLIYPALQPLDVDLPSYQENSNFLFLSKSLMVRFWSEYFTTDRSLEKAMLSRQHVPVESSHLFKFINWSSLLPERFIKGHVYNNP |
| Protein accession: | NP_001077 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged AADAC is approximately 3ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | N-Glycosylation during translation is essential for human arylacetamide deacetylase enzyme activity.Muta K, Fukami T, Nakajima M, Yokoi T Biochem Pharmacol. 2013 Oct 11. pii: S0006-2952(13)00651-5. doi: 10.1016/j.bcp.2013.10.001. |