| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr |
| Brand: | Abnova |
| Reference: | H00000010-M01 |
| Product name: | NAT2 monoclonal antibody (M01), clone 3B5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant NAT2. |
| Clone: | 3B5 |
| Isotype: | IgG2a Kappa |
| Gene id: | 10 |
| Gene name: | NAT2 |
| Gene alias: | AAC2|PNAT |
| Gene description: | N-acetyltransferase 2 (arylamine N-acetyltransferase) |
| Genbank accession: | BC015878 |
| Immunogen: | NAT2 (AAH15878, 96 a.a. ~ 195 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PPVNKYSTGMVHLLLQVTIDGRNYIVDAGSGSSSQMWQPLELISGKDQPQVPCIFCLTEERGIWYLDQIRREQYITNKEFLNSHLLPKKKHQKIYLFTLE |
| Protein accession: | AAH15878 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of NAT2 expression in transfected 293T cell line by NAT2 monoclonal antibody (M01), clone 3B5. Lane 1: NAT2 transfected lysate(33.5 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |