Cart 13 Product Products 4 212,70 € (empty)
No products
To be determined Shipping
4 212,70 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 13 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 4 212,70 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 4 212,70 €
Data sheet of NAT1 (Human) Recombinant Protein (P01)
| Brand | Abnova |
| Product type | Proteins |
| Host species | Wheat Germ (in vitro) |
| Applications | AP,Array,ELISA,WB-Re |
More info about NAT1 (Human) Recombinant Protein (P01)
| Brand: | Abnova |
| Reference: | H00000009-P01 |
| Product name: | NAT1 (Human) Recombinant Protein (P01) |
| Product description: | Human NAT1 full-length ORF ( NP_000653.3, 1 a.a. - 290 a.a.) recombinant protein with GST-tag at N-terminal. |
| Gene id: | 9 |
| Gene name: | NAT1 |
| Gene alias: | AAC1|NATI |
| Gene description: | N-acetyltransferase 1 (arylamine N-acetyltransferase) |
| Genbank accession: | NM_000662.4 |
| Immunogen sequence/protein sequence: | MDIEAYLERIGYKKSRNKLDLETLTDILQHQIRAVPFENLNIHCGDAMDLGLEAIFDQVVRRNRGGWCLQVNHLLYWALTTIGFETTMLGGYVYSTPAKKYSTGMIHLLLQVTIDGRNYIVDAGFGRSYQMWQPLELISGKDQPQVPCVFRLTEENGFWYLDQIRREQYIPNEEFLHSDLLEDSKYRKIYSFTLKPRTIEDFESMNTYLQTSPSSVFTSKSFCSLQTPDGVHCLVGFTLTHRRFNYKDNTDLIEFKTLSEEEIEKVLKNIFNISLQRKLVPKHGDRFFTI |
| Protein accession: | NP_000653.3 |
| Preparation method: | in vitro wheat germ expression system |
| Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Quality control testing picture: |  |
| Note: | Best use within three months from the date of receipt of this protein. |
| Tag: | GST |
| Product type: | Proteins |
| Host species: | Wheat Germ (in vitro) |
| Antigen species / target species: | Human |
| Applications: | AP,Array,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Phenotype of the Most Common "Slow Acetylator" Arylamine N-Acetyltransferase 1 Genetic Variant (NAT1*14B) is Substrate-Dependent.Millner LM, Doll MA, Cai J, States JC, Hein DW. Drug Metab Dispos. 2011 Oct 18. |