| Brand: | Abnova |
| Reference: | H00006499-M05 |
| Product name: | SKIV2L monoclonal antibody (M05), clone 1E5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SKIV2L. |
| Clone: | 1E5 |
| Isotype: | IgG2a Kappa |
| Gene id: | 6499 |
| Gene name: | SKIV2L |
| Gene alias: | 170A|DDX13|HLP|SKI2|SKI2W|SKIV2 |
| Gene description: | superkiller viralicidic activity 2-like (S. cerevisiae) |
| Genbank accession: | NM_006929 |
| Immunogen: | SKIV2L (NP_008860, 1125 a.a. ~ 1233 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | DQLPNTLKQGIERVRAVAKRIGEVQVACGLNQTVEEFVGELNFGLVEVVYEWARGMPFSELAGLSGTPEGLVVRCIQRLAEMCRSLRGAARLVGEPVLGAKMETAATLL |
| Protein accession: | NP_008860 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | SKIV2L monoclonal antibody (M05), clone 1E5. Western Blot analysis of SKIV2L expression in Hela S3 NE. |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |