View larger

SFRP4 (Human) Recombinant Protein (Q01)

New product

527,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SFRP4 (Human) Recombinant Protein (Q01)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about SFRP4 (Human) Recombinant Protein (Q01)

Brand: Abnova
Reference: H00006424-Q01
Product name: SFRP4 (Human) Recombinant Protein (Q01)
Product description: Human SFRP4 partial ORF ( NP_003005.1, 211 a.a. - 312 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 6424
Gene name: SFRP4
Gene alias: FRP-4|FRPHE|MGC26498
Gene description: secreted frizzled-related protein 4
Genbank accession: NM_003014.2
Immunogen sequence/protein sequence: CNEVTTVVDVKEIFKSSSPIPRTQVPLITNSSCQCPHILPHQDVLIMCYEWRSRMMLLENCLVEKWRDQLSKRSIQWEERLQEQRRTVQDKKKTAGRTSRSN
Protein accession: NP_003005.1
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00006424-Q01-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Loss of secreted frizzled-related protein 4 correlates with an aggressive phenotype and predicts poor outcome in ovarian cancer patients.Jacob F, Ukegjini K, Nixdorf S, Ford CE, Olivier J, Caduff R, Scurry JP, Guertler R, Hornung D, Mueller R, Fink DA, Hacker NF, Heinzelmann-Schwarz VA.
PLoS One. 2012;7(2):e31885. Epub 2012 Feb 21.

Reviews

Buy SFRP4 (Human) Recombinant Protein (Q01) now

Add to cart