| Brand: | Abnova |
| Reference: | H00006348-P01 |
| Product name: | CCL3 (Human) Recombinant Protein (P01) |
| Product description: | Human CCL3 full-length ORF ( NP_002974.1, 1 a.a. - 92 a.a.) recombinant protein with GST-tag at N-terminal. |
| Gene id: | 6348 |
| Gene name: | CCL3 |
| Gene alias: | G0S19-1|LD78ALPHA|MIP-1-alpha|MIP1A|SCYA3 |
| Gene description: | chemokine (C-C motif) ligand 3 |
| Genbank accession: | NM_002983.1 |
| Immunogen sequence/protein sequence: | MQVSTAALAVLLCTMALCNQFSASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA |
| Protein accession: | NP_002974.1 |
| Preparation method: | in vitro wheat germ expression system |
| Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Quality control testing picture: |  |
| Note: | Best use within three months from the date of receipt of this protein. |
| Tag: | GST |
| Product type: | Proteins |
| Host species: | Wheat Germ (in vitro) |
| Antigen species / target species: | Human |
| Applications: | AP,Array,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | NK cell intrinsic regulation of MIP-1α by granzyme M.Baschuk N, Wang N, Watt SV, Halse H, House C, Bird PI, Strugnell R, Trapani JA, Smyth MJ, Andrews DM Cell Death Dis. 2014 Mar 13;5:e1115. doi: 10.1038/cddis.2014.74. |