Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of Human Myoglobin recombinant protein
| Brand | ProteoGenix |
| Product type | Proteins |
| Origin species | Human |
| Host species | Mammalian |
More info about Human Myoglobin recombinant protein
| Proteogenix reference: | PX-P4024-100 |
| Protein delivered with tag?: | Yes |
| Product name: | Human Myoglobin recombinant protein |
| Description: | Serves as a reserve supply of oxygen and facilitates the movement of oxygen within muscles. |
| Fragment type: | Full-length |
| Expression system: | Eukaryotic expression |
| Molecular weight with tag if any: | 18.06kDa |
| Purity estimated: | 70% |
| Uniprot id: | P02144 |
| Uniprot link: | http://www.uniprot.org/uniprot/P02144 |
| Aliases / synonyms: | myoglobin, PVALB, MB, MGC13548 |
| Protein sequence (w/o tag): | MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQGSHHHHHH |
| Form: | Lyophilized |
| Buffer: | 50 mM Tris-HCl pH 7.5, 150 mM NaCl |
| Storage condition: | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Delivery condition: | any condition |
| Delivery lead time in business days: | 10-25 |