View larger

B1 (Human) Recombinant Protein (P01)

New product

374,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of B1 (Human) Recombinant Protein (P01)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about B1 (Human) Recombinant Protein (P01)

Brand: Abnova
Reference: H00027241-P01
Product name: B1 (Human) Recombinant Protein (P01)
Product description: Human B1 full-length ORF ( AAH32715, 1 a.a. - 310 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 27241
Gene name: BBS9
Gene alias: B1|C18|D1|MGC118917|PTHB1
Gene description: Bardet-Biedl syndrome 9
Genbank accession: BC032715
Immunogen sequence/protein sequence: MGYLRIFSPHPAKTGDGAQAEDLLLEVDLRDPVLQVEVGKFVSGTEMLHLAVLHSRKLCVYSVSGTLGNVEHGNQCQMKLMYEHNLQRTACNMTYGSFGGVKGRDLICIQSMDGMLMVFEQESYAFGRFLPGFLLPGPLAYSSRTDSFLTVSSCQQVESYKYQVLAFATDADKRQETEQQKLGSGKRLVVDWTLNIGEQALDICIVSFNQSASSVFVLGERNFFCLKDNGQIRFMKKLDWSPSCFLPYCSVSEGTINTLIGNHNNMLHIYQDVTLKWATQLPHIPVAVRVGCLQFSLWKHLLPRSSTLEK
Protein accession: AAH32715
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00027241-P01-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice

Buy B1 (Human) Recombinant Protein (P01) now

Add to cart