Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Mouse |
Host species | Rabbit |
Applications | IHC-P,IF,WB-Tr |
Brand: | Abnova |
Reference: | PAB31674 |
Product name: | SST polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against partial recombinant human SST. |
Isotype: | IgG |
Gene id: | 6750 |
Gene name: | SST |
Gene alias: | SMST |
Gene description: | somatostatin |
Immunogen: | Recombinant protein corresponding to amino acids 25-107 of human SST. |
Immunogen sequence/protein sequence: | APSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEPNQTENDALEPEDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKN |
Protein accession: | P61278 |
Form: | Liquid |
Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000) Western Blot (0.4 ug/mL) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
Storage instruction: | Store at 4°C for short term storage. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse |
Application image: | ![]() |
Application image note: | Immunofluorescent staining of mouse dentate gyrus shows moderate to strong positivity in a subset of neurons in the polymorph layer. |
Applications: | IHC-P,IF,WB-Tr |
Shipping condition: | Dry Ice |