| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Ti,IHC-P,IF |
| Brand: | Abnova |
| Reference: | PAB31628 |
| Product name: | TAGLN polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial recombinant human TAGLN. |
| Isotype: | IgG |
| Gene id: | 6876 |
| Gene name: | TAGLN |
| Gene alias: | DKFZp686P11128|SM22|SMCC|TAGLN1|WS3-10 |
| Gene description: | transgelin |
| Immunogen: | Recombinant protein corresponding to amino acids 19-94 of human TAGLN. |
| Immunogen sequence/protein sequence: | EKKYDEELEERLVEWIIVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLYPDGSKPVKVPENPPSMVFKQMEQV |
| Protein accession: | Q01995 |
| Form: | Liquid |
| Recommend dilutions: | Immunofluorescence (1-4 ug/mL) Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500) Western Blot (0.4 ug/mL) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C for short term storage. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria & microtubules. Antibody staining is shown in green. |
| Applications: | WB-Ti,IHC-P,IF |
| Shipping condition: | Dry Ice |
| Publications: | Stromal contribution to the colorectal cancer transcriptome.Isella C, Terrasi A, Bellomo SE, Petti C, Galatola G, Muratore A, Mellano A, Senetta R, Cassenti A, Sonetto C, Inghirami G, Trusolino L, Fekete Z, De Ridder M, Cassoni P, Storme G, Bertotti A, Medico E. Nat Genet. 2015 Apr;47(4):312-9. doi: 10.1038/ng.3224. Epub 2015 Feb 23. |