Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ACO1 polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse,Rat |
| Host species | Rabbit |
| Applications | WB,WB-Ce,IHC-P,IF |
More info about ACO1 polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB31627 |
| Product name: | ACO1 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial recombinant human ACO1. |
| Isotype: | IgG |
| Gene id: | 48 |
| Gene name: | ACO1 |
| Gene alias: | ACONS|IREB1|IREBP|IREBP1|IRP1 |
| Gene description: | aconitase 1, soluble |
| Immunogen: | Recombinant protein corresponding to amino acids 800-889 of human ACO1. |
| Immunogen sequence/protein sequence: | YERIHRSNLVGMGVIPLEYLPGENADALGLTGQERYTIIIPENLKPQMKVQVKLDTGKTFQAVMRFDTDVELTYFLNGGILNYMIRKMAK |
| Protein accession: | P21399 |
| Form: | Liquid |
| Recommend dilutions: | Immunofluorescence (1-4 ug/mL) Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500) Western Blot (0.4 ug/mL) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C for short term storage. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & mitochondria. Antibody staining is shown in green. |
| Applications: | WB,WB-Ce,IHC-P,IF |
| Shipping condition: | Dry Ice |
| Publications: | Dysregulation of IRP1-mediated iron metabolism causes gamma ray-specific radioresistance in leukemia cells.Haro KJ, Sheth A, Scheinberg DA. PLoS One. 2012;7(11):e48841. doi: 10.1371/journal.pone.0048841. Epub 2012 Nov 14. |