Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of QKI polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse,Rat |
| Host species | Rabbit |
| Applications | WB-Ce,WB-Ti,IHC-P,IF |
More info about QKI polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB31618 |
| Product name: | QKI polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial recombinant human QKI. |
| Isotype: | IgG |
| Gene id: | 9444 |
| Gene name: | QKI |
| Gene alias: | DKFZp586I0923|Hqk|QK|QK1|QK3 |
| Gene description: | quaking homolog, KH domain RNA binding (mouse) |
| Immunogen: | Recombinant protein corresponding to amino acids 163-311 of human QKI. |
| Immunogen sequence/protein sequence: | RAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAILNGTYRDANIKSPALAFSLAATAQAAPRIITGPAPVLPPAALRTPTPAGPTIMPLIRQIQTAVMPNGTPHPTAAIVPPGPEAGLIYTPYEYPYTLAPATSILEYPIEPSGVL |
| Protein accession: | Q96PU8 |
| Form: | Liquid |
| Recommend dilutions: | Immunofluorescence (1-4 ug/mL) Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C for short term storage. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green. |
| Applications: | WB-Ce,WB-Ti,IHC-P,IF |
| Shipping condition: | Dry Ice |
| Publications: | Expression of Quaking RNA-Binding Protein in the Adult and Developing Mouse Retina.Suiko T, Kobayashi K, Aono K, Kawashima T, Inoue K, Ku L, Feng Y, Koike C. PLoS One. 2016 May 19;11(5):e0156033. doi: 10.1371/journal.pone.0156033. eCollection 2016. |