| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | IHC-P,WB-Tr |
| Brand: | Abnova |
| Reference: | PAB31552 |
| Product name: | DMRT1 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial recombinant human DMRT1 |
| Isotype: | IgG |
| Gene id: | 1761 |
| Gene name: | DMRT1 |
| Gene alias: | DMT1 |
| Gene description: | doublesex and mab-3 related transcription factor 1 |
| Immunogen: | Recombinant protein corresponding to human DMRT1. |
| Immunogen sequence/protein sequence: | LAADSASGEVGNPLGGSPVKNSLRGLPGPYVPGQTGNQWQMKNMENRHAMSSQYRMHSYYPPPSYLGQSVPQFFTFEDAPSYPEARASVFSPPSSQDSGLVSLSSSSPISNKSTKAVLECEPASEPSSFTVTPVI |
| Protein accession: | Q9Y5R6 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:1000-1:2500) Western Blot (1:500-1:1000) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human testis with DMRT1 polyclonal antibody (Cat # PAB31552) shows strong nuclear positivity in fraction of cells in seminiferous ducts. |
| Applications: | IHC-P,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | The human testis-specific proteome defined by transcriptomics and antibody-based profiling.Djureinovic D, Fagerberg L, Hallstrom B, Danielsson A, Lindskog C, Uhlen M, Ponten F. Mol Hum Reprod. 2014 Jun;20(6):476-88. doi: 10.1093/molehr/gau018. Epub 2014 Mar 5. |