| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Ce,IHC-P |
| Brand: | Abnova |
| Reference: | PAB31544 |
| Product name: | KIF12 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial recombinant human KIF12 |
| Isotype: | IgG |
| Gene id: | 113220 |
| Gene name: | KIF12 |
| Gene alias: | RP11-56P10.3 |
| Gene description: | kinesin family member 12 |
| Immunogen: | Recombinant protein corresponding to human KIF12. |
| Immunogen sequence/protein sequence: | SAQCLPETLSTLRYASRAQRVTTRPQAPKSPVAKQPQRLETEMLQLQEENRRLQFQLDQMDCKASGLSGARVAWAQRNLYGML |
| Protein accession: | Q96FN5 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human rectum with KIF12 polyclonal antibody (Cat # PAB31544) shows strong cytoplasmic positivity in glandular cells. |
| Applications: | WB-Ce,IHC-P |
| Shipping condition: | Dry Ice |