Cart 116 Product Products 36 322,32 € (empty)
-
-
-
1 x GPR113...259,07 € -
-
-
-
-
-
-
1 x CYP11A1...259,07 € -
1 x Cadherin-2...259,07 € -
1 x Histone H3...259,07 € -
1 x TLR8...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x FUT2...259,07 € -
-
-
-
-
1 x hCAP-H...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x MafF...259,07 € -
-
-
-
-
-
-
-
-
-
-
1 x SMUG1...259,07 € -
-
-
-
-
-
-
-
-
-
-
1 x ZKSCAN5...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
No products
To be determined Shipping
36 322,32 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 116 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 36 322,32 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 36 322,32 €
Data sheet of CDR2 polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | IHC-P,WB-Tr |
More info about CDR2 polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB31524 |
| Product name: | CDR2 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial recombinant human CDR2 |
| Isotype: | IgG |
| Gene id: | 1039 |
| Gene name: | CDR2 |
| Gene alias: | CDR62|Yo |
| Gene description: | cerebellar degeneration-related protein 2, 62kDa |
| Immunogen: | Recombinant protein corresponding to human CDR2. |
| Immunogen sequence/protein sequence: | GVEKLVPDSLYVPFKEPSQSLLEEMFLTVPESHRKPLKRSSSETILSSLAGSDIVKGHEETCIRRAKAVKQRGISLLHEVDTQYSALKVKYEELLKKCQEEQDSLSHKAVQTSRAAAKDLTGV |
| Protein accession: | Q01850 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:1000-1:2500) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human cerebral cortex with CDR2 polyclonal antibody (Cat # PAB31524) shows nuclear positivity in neurons. |
| Applications: | IHC-P,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | CDR2L Antibodies: A New Player in Paraneoplastic Cerebellar Degeneration.Eichler TW, Totland C, Haugen M, Qvale TH, Mazengia K, Storstein A, Haukanes BI, Vedeler CA. PLoS One. 2013 Jun 18;8(6):e66002. doi: 10.1371/journal.pone.0066002. Print 2013. |