| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | IHC-P |
| Brand: | Abnova |
| Reference: | PAB31503 |
| Product name: | DKC1 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial recombinant human DKC1. |
| Isotype: | IgG |
| Gene id: | 1736 |
| Gene name: | DKC1 |
| Gene alias: | CBF5|DKC|FLJ97620|NAP57|NOLA4|XAP101 |
| Gene description: | dyskeratosis congenita 1, dyskerin |
| Immunogen: | Recombinant protein corresponding to human DKC1. |
| Immunogen sequence/protein sequence: | KERKSLPEEDVAEIQHAEEFLIKPESKVAKLDTSQWPLLLKNFDKLNVRTTHYTPLACGSNPLKREIGDYIRTGFINLDKPSNPSSHEVVAWIRRILRVEKTGHSGTL |
| Protein accession: | O60832 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human gall bladder with DKC1 polyclonal antibody (Cat # PAB31503) shows distinct nuclear positivity in glandular cells. |
| Applications: | IHC-P |
| Shipping condition: | Dry Ice |
| Publications: | snoRNPs Regulate Telomerase Activity in Neuroblastoma and Are Associated with Poor Prognosis.von Stedingk K, Koster J, Piqueras M, Noguera R, Navarro S, Pahlman S, Versteeg R, Ora I, Gisselsson D, Lindgren D, Axelson H. Transl Oncol. 2013 Aug 1;6(4):447-57. Print 2013 Aug. |