Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PTGES polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Host species | Rabbit |
| Applications | WB-Ce,IHC-P,IF |
More info about PTGES polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB31502 |
| Product name: | PTGES polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial recombinant human PTGES. |
| Isotype: | IgG |
| Gene id: | 9536 |
| Gene name: | PTGES |
| Gene alias: | MGC10317|MGST-IV|MGST1-L1|MGST1L1|MPGES|PGES|PIG12|PP102|PP1294|TP53I12|mPGES-1 |
| Gene description: | prostaglandin E synthase |
| Immunogen: | Recombinant protein corresponding to human PTGES. |
| Immunogen sequence/protein sequence: | ITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAPRNDM |
| Protein accession: | O14684 |
| Form: | Liquid |
| Recommend dilutions: | Immunofluorescence (1-4 ug/mL) Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human placenta with PTGES polyclonal antibody (Cat # PAB31502) shows cytoplasmic positivity in a subset of trophoblastic cells. |
| Applications: | WB-Ce,IHC-P,IF |
| Shipping condition: | Dry Ice |
| Publications: | Active smoking increases microsomal PGE2-synthase-1/PGE-receptor-4 axis in human abdominal aortic aneurysms.Dilme JF, Sola-Villa D, Bellmunt S, Romero JM, Escudero JR, Camacho M, Vila L. Mediators Inflamm. 2014;2014:316150. doi: 10.1155/2014/316150. Epub 2014 Apr 30. |