Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PPM1B polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB,IHC-P,IF |
More info about PPM1B polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB31485 |
| Product name: | PPM1B polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial recombinant human PPM1B. |
| Isotype: | IgG |
| Gene id: | 5495 |
| Gene name: | PPM1B |
| Gene alias: | MGC21657|PP2C-beta-X|PP2CB|PP2CBETA|PPC2BETAX |
| Gene description: | protein phosphatase 1B (formerly 2C), magnesium-dependent, beta isoform |
| Immunogen: | Recombinant protein corresponding to amino acids 359-463 of human PPM1B. |
| Immunogen sequence/protein sequence: | KRNVIEAVYSRLNPHRESDGASDEAEESGSQGKLVEALRQMRINHRGNYRQLLEEMLTSYRLAKVEGEESPAEPAATATSSNSDAGNPVTMQESHTESESGLAEL |
| Protein accession: | O75688 |
| Form: | Liquid |
| Recommend dilutions: | Immunofluorescence (1-4 ug/mL) Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C for short term storage. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescent staining of human cell line A-431 shows positivity in nucleoli & cytoplasm. Antibody staining is shown in green. |
| Applications: | WB,IHC-P,IF |
| Shipping condition: | Dry Ice |