Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of JMJD1B polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse,Rat |
| Host species | Rabbit |
| Applications | WB,WB-Ce,IHC-P,IF |
More info about JMJD1B polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB31483 |
| Product name: | JMJD1B polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial recombinant human JMJD1B. |
| Isotype: | IgG |
| Gene id: | 51780 |
| Gene name: | JMJD1B |
| Gene alias: | 5qNCA|C5orf7|KDM3B|KIAA1082 |
| Gene description: | jumonji domain containing 1B |
| Immunogen: | Recombinant protein corresponding to amino acids 307-448 of human JMJD1B. |
| Immunogen sequence/protein sequence: | GEVDSNGSDGGEASRGPWKGGNASGEPGLDQRAKQPPSTFVPQINRNIRFATYTKENGRTLVVQDEPVGGDTPASFTPYSTATGQTPLAPEVGGAENKEAGKTLEQVGQGIVASAAVVTTASSTPNTVRISDTGLAAGTVPE |
| Protein accession: | Q7LBC6 |
| Form: | Liquid |
| Recommend dilutions: | Immunofluorescence (1-4 ug/mL) Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C for short term storage. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green. |
| Applications: | WB,WB-Ce,IHC-P,IF |
| Shipping condition: | Dry Ice |
| Publications: | CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer.McCleland ML, Mesh K, Lorenzana E, Chopra VS, Segal E, Watanabe C, Haley B, Mayba O, Yaylaoglu M, Gnad F, Firestein R. J Clin Invest. 2016 Feb;126(2):639-52. doi: 10.1172/JCI83265. Epub 2016 Jan 11. |