| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Rat |
| Host species | Rabbit |
| Applications | WB-Ce,IHC-P,IF |
| Brand: | Abnova |
| Reference: | PAB31477 |
| Product name: | DLC1 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial recombinant human DLC1. |
| Isotype: | IgG |
| Gene id: | 10395 |
| Gene name: | DLC1 |
| Gene alias: | ARHGAP7|FLJ21120|HP|STARD12|p122-RhoGAP |
| Gene description: | deleted in liver cancer 1 |
| Immunogen: | Recombinant protein corresponding to human DLC1. |
| Immunogen sequence/protein sequence: | RSWEEHVTHWMGQPFNSDDRNTACHHGLVADSLQASMEKDATLNVDRKEKCVSLPDCCHGSELRDFPGRPMGHLSKDVDENDSHEGEDQFLSLEASTETLVHVSDEDNNADLCLTDDKQVLNTQGQ |
| Protein accession: | Q96QB1 |
| Form: | Liquid |
| Recommend dilutions: | Immunofluorescence (1-4 ug/mL) Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:2500-1:5000) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: | ![]() |
| Application image note: | Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human duodenum with DLC1 polyclonal antibody (Cat # PAB31477) shows distinct positivity of microvilli in glandular cells. |
| Applications: | WB-Ce,IHC-P,IF |
| Shipping condition: | Dry Ice |
| Publications: | The transcriptional coactivators megakaryoblastic leukemia 1/2 mediate the effects of loss of the tumor suppressor deleted in liver cancer 1.Muehlich S, Hampl V, Khalid S, Singer S, Frank N, Breuhahn K, Gudermann T, Prywes R. Oncogene. 2012 Aug 30;31(35):3913-23. doi: 10.1038/onc.2011.560. Epub 2011 Dec 5. |