Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SEMA4D polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Ce,IHC-P |
More info about SEMA4D polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB31457 |
| Product name: | SEMA4D polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial recombinant human SEMA4D. |
| Isotype: | IgG |
| Gene id: | 10507 |
| Gene name: | SEMA4D |
| Gene alias: | C9orf164|CD100|FLJ33485|FLJ34282|FLJ39737|FLJ46484|M-sema-G|MGC169138|MGC169141|SEMAJ|coll-4 |
| Gene description: | sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4D |
| Immunogen: | Recombinant protein corresponding to human SEMA4D. |
| Immunogen sequence/protein sequence: | LLIGKKKPKSDFCDREQSLKETLVEPGSFSQQNGEHPKPALDTGYETEQDTITSKVPTDREDSQRIDDLSARDKPFDVKCELKFADSDADGD |
| Protein accession: | Q92854 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human lymph node with SEMA4D polyclonal antibody (Cat # PAB31457) shows cytoplasmic positivity in germinal center cells and non-germinal center cells. |
| Applications: | WB-Ce,IHC-P |
| Shipping condition: | Dry Ice |
| Publications: | The combined expression of Semaphorin4D and PlexinB1 predicts disease recurrence in colorectal cancer.Ikeya T, Maeda K, Nagahara H, Shibutani M, Iseki Y, Hirakawa K. BMC Cancer. 2016 Jul 25;16:525. doi: 10.1186/s12885-016-2577-6. |