Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SIRT2 polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | IHC-P,IF,WB-Tr |
More info about SIRT2 polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB31424 |
| Product name: | SIRT2 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial recombinant human SIRT2. |
| Isotype: | IgG |
| Gene id: | 22933 |
| Gene name: | SIRT2 |
| Gene alias: | SIR2|SIR2L|SIR2L2 |
| Gene description: | sirtuin (silent mating type information regulation 2 homolog) 2 (S. cerevisiae) |
| Immunogen: | Recombinant protein corresponding to human SIRT2. |
| Immunogen sequence/protein sequence: | KDKGLLLRCYTQNIDTLERIAGLEQEDLVEAHGTFYTSHCVSASCRHEYPLSWMKEKIFSEVTPKCEDCQSLVKPDIVFFGESLPARFFSCMQSDFLKVDLLL |
| Protein accession: | Q8IXJ6 |
| Form: | Liquid |
| Recommend dilutions: | Immunofluorescence (1-4 ug/mL) Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:1000-1:2500) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human cerebral cortex with SIRT2 polyclonal antibody (Cat # PAB31424) shows cytoplasmic positivity in nerve fibers. |
| Applications: | IHC-P,IF,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | A chromatin modifier genetic screen identifies SIRT2 as a modulator of response to targeted therapies through the regulation of MEK kinase activity.Bajpe PK, Prahallad A, Horlings H, Nagtegaal I, Beijersbergen R, Bernards R. Oncogene. 2015 Jan 22;34(4):531-6. doi: 10.1038/onc.2013.588. Epub 2014 Jan 27. |