| Brand | Abnova | 
| Product type | Primary antibodies | 
| Reactivity | Human | 
| Host species | Rabbit | 
| Applications | WB-Ti,IHC-P,IF | 
| Brand: | Abnova | 
| Reference: | PAB31405 | 
| Product name: | NFATC2 polyclonal antibody | 
| Product description: | Rabbit polyclonal antibody raised against partial recombinant human NFATC2. | 
| Isotype: | IgG | 
| Gene id: | 4773 | 
| Gene name: | NFATC2 | 
| Gene alias: | KIAA0611|NFAT1|NFATP | 
| Gene description: | nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 | 
| Immunogen: | Recombinant protein corresponding to human NFATC2. | 
| Immunogen sequence/protein sequence: | DFSILFDYEYLNPNEEEPNAHKVASPPSGPAYPDDVLDYGLKPYSPLASLSGEPPGRFGEPDRVGPQKFLSAAKPAGASGLSPRIEITPSHELIQAVGPLRMRDAGLLVEQPPLAGVAASPRFTLPV | 
| Protein accession: | Q13469 | 
| Form: | Liquid | 
| Recommend dilutions: | Immunofluorescence (1-4 ug/mL) Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user.  | 
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). | 
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing.  | 
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. | 
| Product type: | Primary antibodies | 
| Host species: | Rabbit | 
| Antigen species / target species: | Human | 
| Reactivity: | Human | 
| Application image: | ![]()  | 
| Application image note: | Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human lymph node with NFATC2 polyclonal antibody (Cat # PAB31405) shows strong cytoplasmic positivity in germinal center cells and non-germinal center cells. | 
| Applications: | WB-Ti,IHC-P,IF | 
| Shipping condition: | Dry Ice | 
| Publications: | Galanin modulates the neural niche to favour perineural invasion in head and neck cancer.Scanlon CS, Banerjee R, Inglehart RC, Liu M, Russo N, Hariharan A, van Tubergen EA, Corson SL, Asangani IA, Mistretta CM, Chinnaiyan AM, DâSilva NJ. Nat Commun. 2015 Apr 28;6:6885. doi: 10.1038/ncomms7885.  |