Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of MCL1 polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Ce,IHC-P |
More info about MCL1 polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB31403 |
| Product name: | MCL1 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial recombinant human MCL1. |
| Isotype: | IgG |
| Gene id: | 4170 |
| Gene name: | MCL1 |
| Gene alias: | BCL2L3|EAT|MCL1L|MCL1S|MGC104264|MGC1839|TM |
| Gene description: | myeloid cell leukemia sequence 1 (BCL2-related) |
| Immunogen: | Recombinant protein corresponding to human MCL1. |
| Immunogen sequence/protein sequence: | DAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDG |
| Protein accession: | Q07820 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500) Western Blot (1:500-1:1000) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human lymph node with MCL1 polyclonal antibody (Cat # PAB31403) shows strong cytoplasmic positivity in reaction center cells. |
| Applications: | WB-Ce,IHC-P |
| Shipping condition: | Dry Ice |
| Publications: | Targeting Bcl-2/Bcl-XL induces antitumor activity in uveal melanoma patient-derived xenografts.Nemati F, de Montrion C, Lang G, Kraus-Berthier L, Carita G, Sastre-Garau X, Berniard A, Vallerand D, Geneste O, de Plater L, Pierre A, Lockhart B, Desjardins L, Piperno-Neumann S, Depil S, Decaudin D. PLoS One. 2014 Jan 13;9(1):e80836. doi: 10.1371/journal.pone.0080836. eCollection 2014. |