Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of MMP3 polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Ce,IHC-P |
More info about MMP3 polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB31395 |
| Product name: | MMP3 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial recombinant human MMP3. |
| Isotype: | IgG |
| Gene id: | 4314 |
| Gene name: | MMP3 |
| Gene alias: | CHDS6|MGC126102|MGC126103|MGC126104|MMP-3|SL-1|STMY|STMY1|STR1 |
| Gene description: | matrix metallopeptidase 3 (stromelysin 1, progelatinase) |
| Immunogen: | Recombinant protein corresponding to human MMP3. |
| Immunogen sequence/protein sequence: | MYPLYHSLTDLTRFRLSQDDINGIQSLYGPPPDSPETPLVPTEPVPPEPGTPANCDPALSFDAVSTLRGEILIFKDRHFWRKSLRKLEPELHLISSFWPSLPSGVDAAYEVTSKDLVFIFKGNQFWAI |
| Protein accession: | P08254 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human lymph node with MMP3 polyclonal antibody (Cat # PAB31395) shows strong cytoplasmic positivity in reaction center cells and lymphoid cells outside reaction centra. |
| Applications: | WB-Ce,IHC-P |
| Shipping condition: | Dry Ice |
| Publications: | Tumor necrosis factor-α-accelerated degradation of type I collagen in human skin is associated with elevated matrix metalloproteinase (MMP)-1 and MMP-3 ex vivo.Agren MS, Schnabel R, Christensen LH, Mirastschijski U. Eur J Cell Biol. 2015 Jan;94(1):12-21. doi: 10.1016/j.ejcb.2014.10.001. Epub 2014 Oct 23. |