Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of MAP1LC3A polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Ti,IHC-P |
More info about MAP1LC3A polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB31392 |
| Product name: | MAP1LC3A polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial recombinant human MAP1LC3A. |
| Isotype: | IgG |
| Gene id: | 84557 |
| Gene name: | MAP1LC3A |
| Gene alias: | LC3|LC3A|MAP1ALC3|MAP1BLC3 |
| Gene description: | microtubule-associated protein 1 light chain 3 alpha |
| Immunogen: | Recombinant protein corresponding to human MAP1LC3A. |
| Immunogen sequence/protein sequence: | MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMS |
| Protein accession: | Q9H492 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human cerebral cortex with MAP1LC3A polyclonal antibody (Cat # PAB31392) shows strong cytoplasmic and nuclear positivity in neuronal cells. |
| Applications: | WB-Ti,IHC-P |
| Shipping condition: | Dry Ice |
| Publications: | Granulovacuolar degeneration (GVD) bodies of Alzheimer's disease (AD) resemble late-stage autophagic organelles.Funk KE, Mrak RE, Kuret J. Neuropathol Appl Neurobiol. 2011 Apr;37(3):295-306. doi: 10.1111/j.1365-2990.2010.01135.x. |