| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse,Rat |
| Host species | Rabbit |
| Applications | WB,WB-Ce,IHC-P |
| Brand: | Abnova |
| Reference: | PAB31295 |
| Product name: | H6PD polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial recombinant human H6PD. |
| Isotype: | IgG |
| Gene id: | 9563 |
| Gene name: | H6PD |
| Gene alias: | DKFZp686A01246|G6PDH|GDH|MGC87643 |
| Gene description: | hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase) |
| Immunogen: | Recombinant protein corresponding to amino acids 43-154 of human H6PD. |
| Immunogen sequence/protein sequence: | WQGLFQLYLDEAGRGHSFSFHGAALTAPKQGQELMAKALESLSCPKDMAPSHCAEHKDQFLQLSQYRQLKTAEDYQALNKDIEAQLQHAGLREAGRIFYFSVPPFAYEDIAR |
| Protein accession: | O95479 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C for short term storage. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: | ![]() |
| Application image note: | Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human liver shows strong cytoplasmic positivity in hepatocytes. |
| Applications: | WB,WB-Ce,IHC-P |
| Shipping condition: | Dry Ice |
| Publications: | Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model.Kato BS, Nicholson G, Neiman M, Rantalainen M, Holmes CC, Barrett A, Uhlen M, Nilsson P, Spector TD, Schwenk JM. Proteome Sci. 2011 Nov 17;9:73. doi: 10.1186/1477-5956-9-73. |