Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of TNC polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | IHC-P |
More info about TNC polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB31294 |
| Product name: | TNC polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial recombinant human TNC. |
| Isotype: | IgG |
| Gene id: | 3371 |
| Gene name: | TNC |
| Gene alias: | HXB|MGC167029|TN |
| Gene description: | tenascin C |
| Immunogen: | Recombinant protein corresponding to amino acids 1765-1898 of human TNC. |
| Immunogen sequence/protein sequence: | RLVKLIPGVEYLVSIIAMKGFEESEPVSGSFTTALDGPSGLVTANITDSEALARWQPAIATVDSYVISYTGEKVPEITRTVSGNTVEYALTDLEPATEYTLRIFAEKGPQKSSTITAKFTTDLDSPRDLTATEV |
| Protein accession: | P24821 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C for short term storage. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human hippocampus shows distinct positivity in neuropil. |
| Applications: | IHC-P |
| Shipping condition: | Dry Ice |
| Publications: | Extracellular Hsp90 mediates an NF-κB dependent inflammatory stromal program: implications for the prostate tumor microenvironment.Bohonowych JE, Hance MW, Nolan KD, Defee M, Parsons CH, Isaacs JS. Prostate. 2014 Apr;74(4):395-407. doi: 10.1002/pros.22761. Epub 2013 Dec 16. |