| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Ce,IHC-P |
| Brand: | Abnova |
| Reference: | PAB31292 |
| Product name: | TNFRSF1B polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial recombinant human TNFRSF1B. |
| Isotype: | IgG |
| Gene id: | 7133 |
| Gene name: | TNFRSF1B |
| Gene alias: | CD120b|TBPII|TNF-R-II|TNF-R75|TNFBR|TNFR1B|TNFR2|TNFR80|p75|p75TNFR |
| Gene description: | tumor necrosis factor receptor superfamily, member 1B |
| Immunogen: | Recombinant protein corresponding to amino acids 62-188 of human TNFRSF1B. |
| Immunogen sequence/protein sequence: | HAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVV |
| Protein accession: | P20333 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C for short term storage. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human stomach shows positivity in plasma. |
| Applications: | WB-Ce,IHC-P |
| Shipping condition: | Dry Ice |
| Publications: | Affinity proteomics reveals elevated muscle proteins in plasma of children with cerebral malaria.Bachmann J, Burte F, Pramana S, Conte I, Brown BJ, Orimadegun AE, Ajetunmobi WA, Afolabi NK, Akinkunmi F, Omokhodion S, Akinbami FO, Shokunbi WA, Kampf C, Pawitan Y, Uhlen M, Sodeinde O, Schwenk JM, Wahlgren M, Fernandez-Reyes D, Nilsson P. PLoS Pathog. 2014 Apr 17;10(4):e1004038. doi: 10.1371/journal.ppat.1004038. eCollection 2014 Apr. |