| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | IHC-P |
| Brand: | Abnova |
| Reference: | PAB31160 |
| Product name: | NPR3 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial recombinant human NPR3. |
| Isotype: | IgG |
| Gene id: | 4883 |
| Gene name: | NPR3 |
| Gene alias: | ANPRC|GUCY2B|NPRC |
| Gene description: | natriuretic peptide receptor C/guanylate cyclase C (atrionatriuretic peptide receptor C) |
| Immunogen: | Recombinant protein corresponding to human NPR3. |
| Immunogen sequence/protein sequence: | GFQHKDSEYSHLTRVAPAYAKMGEMMLALFRHHHWSRAALVYSDDKLERNCYFTLEGVHEVFQEEGLHTSIYSFDETKDLDLEDIVRNIQASERVVIMCASSDTIRSIMLVAHRHGMTSGDYAFFNIELFNSSSYGDGSW |
| Protein accession: | P17342 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C for short term storage. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human testis with NPR3 polyclonal antibody (Cat # PAB31160) shows strong cytoplasmic positivity in leydig cells. |
| Applications: | IHC-P |
| Shipping condition: | Dry Ice |
| Publications: | Molecular subgroups of medulloblastoma: the current consensus.Taylor MD, Northcott PA, Korshunov A, Remke M, Cho YJ, Clifford SC, Eberhart CG, Parsons DW, Rutkowski S, Gajjar A, Ellison DW, Lichter P, Gilbertson RJ, Pomeroy SL, Kool M, Pfister SM. Acta Neuropathol. 2012 Apr;123(4):465-72. doi: 10.1007/s00401-011-0922-z. Epub 2011 Dec 2. |