View larger

LTB4R2 polyclonal antibody

Reference:

Condition: New product

Data sheet of LTB4R2 polyclonal antibody

Brand:	Abnova
Reference:	PAB31136
Product name:	LTB4R2 polyclonal antibody
Product description:	Rabbit polyclonal antibody raised against partial recombinant human LTB4R2.
Isotype:	IgG
Gene id:	56413
Gene name:	LTB4R2
Gene alias:	BLT2\|BLTR2\|JULF2\|KPG_004\|NOP9
Gene description:	leukotriene B4 receptor 2
Immunogen:	Recombinant protein corresponding to human LTB4R2.
Immunogen sequence/protein sequence:	MAPSHRASQVGFCPTPERPLWRLPPTCRPRRMSVCYRPPGNETLLSWKTSR
Protein accession:	Q9NPC1
Form:	Liquid
Recommend dilutions:	Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200) The optimal working dilution should be determined by the end user.
Storage buffer:	In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction:	Store at 4Â°C for short term storage. For long term storage store at -20Â°C. Aliquot to avoid repeated freezing and thawing.
Note:	This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type:	Primary antibodies
Host species:	Rabbit
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human fallopian tube with LTB4R2 polyclonal antibody (Cat # PAB31136) shows distinct positivity in ciliated cells.
Applications:	IHC-P
Shipping condition:	Dry Ice