View larger

ACCN5 polyclonal antibody

Reference:

Condition: New product

Data sheet of ACCN5 polyclonal antibody

Brand	Abnova
Product type	Primary antibodies
Reactivity	Human
Host species	Rabbit
Applications	IHC-P

More info about ACCN5 polyclonal antibody

Brand:	Abnova
Reference:	PAB31131
Product name:	ACCN5 polyclonal antibody
Product description:	Rabbit polyclonal antibody raised against partial recombinant human ACCN5.
Isotype:	IgG
Gene id:	51802
Gene name:	ACCN5
Gene alias:	HINAC\|INAC
Gene description:	amiloride-sensitive cation channel 5, intestinal
Immunogen:	Recombinant protein corresponding to human ACCN5.
Immunogen sequence/protein sequence:	EVQYVEKMEFPAVTFCNLNRFQTDAVAKFGVIFFLWHIVSKVLHLQEITANSTGSREATDFAASHQNFSIVEFIRNKGFYLNNSTLLDCEFFGKPCSPKDFAHVFTEYGNCFTFNHGETLQAKRKVSVSGRGLSLLFNVNQEAFTDNPAL
Protein accession:	Q9NY37
Form:	Liquid
Recommend dilutions:	Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50) The optimal working dilution should be determined by the end user.
Storage buffer:	In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction:	Store at 4Â°C for short term storage. For long term storage store at -20Â°C. Aliquot to avoid repeated freezing and thawing.
Note:	This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type:	Primary antibodies
Host species:	Rabbit
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human prostate with ACCN5 polyclonal antibody (Cat # PAB31131) shows moderate cytoplasmic positivity in glandular cells.
Applications:	IHC-P
Shipping condition:	Dry Ice

Reviews

Be the first to write your review !

Buy ACCN5 polyclonal antibody now

Add to cart