Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | WB-Ce,IHC-P |
Brand: | Abnova |
Reference: | PAB31126 |
Product name: | HMGCL polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against partial recombinant human HMGCL. |
Isotype: | IgG |
Gene id: | 3155 |
Gene name: | HMGCL |
Gene alias: | HL |
Gene description: | 3-hydroxymethyl-3-methylglutaryl-Coenzyme A lyase |
Immunogen: | Recombinant protein corresponding to amino acids 43-184 of human HMGCL. |
Immunogen sequence/protein sequence: | GLQNEKNIVSTPVKIKLIDMLSEAGLSVIETTSFVSPKWVPQMGDHTEVLKGIQKFPGINYPVLTPNLKGFEAAVAAGAKEVVIFGAASELFTKKNINCSIEESFQRFDAILKAAQSANISVRGYVSCALGCPYEGKISPAK |
Protein accession: | P35914 |
Form: | Liquid |
Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
Storage instruction: | Store at 4°C for short term storage. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of human cell line RT-4. |
Applications: | WB-Ce,IHC-P |
Shipping condition: | Dry Ice |
Publications: | Ketone bodies and two-compartment tumor metabolism: stromal ketone production fuels mitochondrial biogenesis in epithelial cancer cells.Martinez-Outschoorn UE, Lin Z, Whitaker-Menezes D, Howell A, Lisanti MP, Sotgia F. Cell Cycle. 2012 Nov 1;11(21):3956-63. doi: 10.4161/cc.22136. Epub 2012 Sep 19. |