No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Rat |
| Host species | Rabbit |
| Applications | WB,WB-Ce,IHC-P |
| Brand: | Abnova |
| Reference: | PAB31125 |
| Product name: | KIF2A polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial recombinant human KIF2A. |
| Isotype: | IgG |
| Gene id: | 3796 |
| Gene name: | KIF2A |
| Gene alias: | HK2|KIF2 |
| Gene description: | kinesin heavy chain member 2A |
| Immunogen: | Recombinant protein corresponding to amino acids 35-144 of human KIF2A. |
| Immunogen sequence/protein sequence: | DNESVTVEWIENGDTKGKEIDLESIFSLNPDLVPDEEIEPSPETPPPPASSAKVNKIVKNRRTVASIKNDPPSRDNRVVGSARARPSQFPEQSSSAQQNGSVSDISPVQA |
| Protein accession: | O00139 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C for short term storage. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of (1) NIH-3T3 cell lysate (Mouse embryonic fibroblast cells), and (2) NBT-II cell lysate (Rat Wistar bladder tumour cells). |
| Applications: | WB,WB-Ce,IHC-P |
| Shipping condition: | Dry Ice |
| Publications: | Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model.Kato BS, Nicholson G, Neiman M, Rantalainen M, Holmes CC, Barrett A, Uhlen M, Nilsson P, Spector TD, Schwenk JM. Proteome Sci. 2011 Nov 17;9:73. doi: 10.1186/1477-5956-9-73. |