View larger

PIK3CB polyclonal antibody

Reference:

Condition: New product

Data sheet of PIK3CB polyclonal antibody

Brand:	Abnova
Reference:	PAB31105
Product name:	PIK3CB polyclonal antibody
Product description:	Rabbit polyclonal antibody raised against partial recombiant human PIK3CB.
Isotype:	IgG
Gene id:	5291
Gene name:	PIK3CB
Gene alias:	DKFZp779K1237\|MGC133043\|PI3K\|PI3KCB\|PI3Kbeta\|PIK3C1\|p110-BETA
Gene description:	phosphoinositide-3-kinase, catalytic, beta polypeptide
Immunogen:	Recombinant protein corresponding to human PIK3CB.
Immunogen sequence/protein sequence:	LSLVGLSWMDWLKQTYPPEHEPSIPENLEDKLYGGKLIVAVHFENCQDVFSFQVSPNMNPIKVNELAIQKRLTIHGK
Protein accession:	P42338
Form:	Liquid
Recommend dilutions:	Western Blot (1:500-1000) Immunofluorescence (1-4 ug/mL) The optimal working dilution should be determined by the end user.
Storage buffer:	In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction:	Store at 4Â°C. For long term storage store at -20Â°C. Aliquot to avoid repeated freezing and thawing.
Note:	This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type:	Primary antibodies
Host species:	Rabbit
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	Immunofluorescent staining of SK-MEL-30 cell line with antibody shows positivity in nucleoplasma (green).
Applications:	WB,IF
Shipping condition:	Dry Ice