No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | IHC-P |
Brand: | Abnova |
Reference: | PAB31099 |
Product name: | KRAS polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against partial recombiant human KRAS. |
Isotype: | IgG |
Gene id: | 3845 |
Gene name: | KRAS |
Gene alias: | C-K-RAS|K-RAS2A|K-RAS2B|K-RAS4A|K-RAS4B|KI-RAS|KRAS1|KRAS2|NS3|RASK2 |
Gene description: | v-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog |
Immunogen: | Recombinant protein corresponding to human KRAS. |
Immunogen sequence/protein sequence: | EGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDV |
Protein accession: | P01116 |
Form: | Liquid |
Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-50) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunohistochemical staining of human colon shows strong membranous and cytoplasmic positivity in glandular cells. |
Applications: | IHC-P |
Shipping condition: | Dry Ice |