View larger

KRAS polyclonal antibody

Reference:

Condition: New product

Data sheet of KRAS polyclonal antibody

Brand:	Abnova
Reference:	PAB31099
Product name:	KRAS polyclonal antibody
Product description:	Rabbit polyclonal antibody raised against partial recombiant human KRAS.
Isotype:	IgG
Gene id:	3845
Gene name:	KRAS
Gene alias:	C-K-RAS\|K-RAS2A\|K-RAS2B\|K-RAS4A\|K-RAS4B\|KI-RAS\|KRAS1\|KRAS2\|NS3\|RASK2
Gene description:	v-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog
Immunogen:	Recombinant protein corresponding to human KRAS.
Immunogen sequence/protein sequence:	EGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDV
Protein accession:	P01116
Form:	Liquid
Recommend dilutions:	Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-50) The optimal working dilution should be determined by the end user.
Storage buffer:	In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction:	Store at 4Â°C. For long term storage store at -20Â°C. Aliquot to avoid repeated freezing and thawing.
Note:	This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type:	Primary antibodies
Host species:	Rabbit
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	Immunohistochemical staining of human colon shows strong membranous and cytoplasmic positivity in glandular cells.
Applications:	IHC-P
Shipping condition:	Dry Ice