View larger

B3GNT2 polyclonal antibody

Reference:

Condition: New product

Data sheet of B3GNT2 polyclonal antibody

Brand:	Abnova
Reference:	PAB31091
Product name:	B3GNT2 polyclonal antibody
Product description:	Rabbit polyclonal antibody raised against partial recombiant human B3GNT2.
Isotype:	IgG
Gene id:	10678
Gene name:	B3GNT2
Gene alias:	B3GN-T1\|B3GN-T2\|B3GNT\|B3GNT-2\|B3GNT1\|BETA3GNT
Gene description:	UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 2
Immunogen:	Recombinant protein corresponding to human B3GNT2.
Immunogen sequence/protein sequence:	DTEFVFKGDDDVFVNTHHILNYLNSLSKTKAKDLFIGDVIHNAGPHRDKKLKYYIPEVVYSGLYPPYAGGGGFLYSGHLALRLYHITDQVHLYPIDDVYTGMCLQKLGLVPEKHKGFRTFDIEEKNKNNICSYVDLMLVHSRKPQEMI
Protein accession:	Q9NY97
Form:	Liquid
Recommend dilutions:	Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-200) Western Blot (1:100-250) The optimal working dilution should be determined by the end user.
Storage buffer:	In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction:	Store at 4Â°C. For long term storage store at -20Â°C. Aliquot to avoid repeated freezing and thawing.
Note:	This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type:	Primary antibodies
Host species:	Rabbit
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	Western Blot (Cell lysate) analysis of RT-4 cell lysate.
Applications:	WB-Ce,IHC-P
Shipping condition:	Dry Ice