| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Ce,IHC-P |
| Brand: | Abnova |
| Reference: | PAB31085 |
| Product name: | IL1R1 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial recombiant human IL1R1. |
| Isotype: | IgG |
| Gene id: | 3554 |
| Gene name: | IL1R1 |
| Gene alias: | CD121A|D2S1473|IL-1R-alpha|IL1R|IL1RA|P80 |
| Gene description: | interleukin 1 receptor, type I |
| Immunogen: | Recombinant protein corresponding to human IL1R1. |
| Immunogen sequence/protein sequence: | VAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENKPTRPVIVSPANETMEVDLGSQIQLICNVTGQLSDIAYWKWNGSVIDEDDPVLGEDYYSVENPANKRRSTLITVLNISEIESRFYKHPFTCFAKNTHGIDAAYIQLIYPVTNFQK |
| Protein accession: | P14778 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1000) Western Blot (1:100-250) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot (Cell lysate) analysis of U-138 cell lysate. |
| Applications: | WB-Ce,IHC-P |
| Shipping condition: | Dry Ice |