Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of NDUFB5 polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB,IHC-P,IF |
More info about NDUFB5 polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB31074 |
| Product name: | NDUFB5 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial recombiant human NDUFB5. |
| Isotype: | IgG |
| Gene id: | 4711 |
| Gene name: | NDUFB5 |
| Gene alias: | CI-SGDH|DKFZp686N02262|FLJ30597|MGC111204|MGC12314|SGDH |
| Gene description: | NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 5, 16kDa |
| Immunogen: | Recombinant protein corresponding to human NDUFB5. |
| Immunogen sequence/protein sequence: | EGYVPEHWEYYKHPISRWIARNFYDSPEKIYERTMAVLQIEAEKAELRVKELEVRKLMHVRGDGPWYYYETIDKELIDHSPKATPDN |
| Protein accession: | O43674 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-200) Western Blot (1:100-250) Immunofluorescence (1-4 ug/mL) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescent staining of U-2 OS cell line with antibody shows positivity in nucleoplasm and mitochondria (green). |
| Applications: | WB,IHC-P,IF |
| Shipping condition: | Dry Ice |
| Publications: | p16(Ink4a)-induced senescence of pancreatic beta cells enhances insulin secretion.Aharon Helman, Agnes Klochendler, Narmen Azazmeh, Yael Gabai, Elad Horwitz, Shira Anzi, Avital Swisa, Reba Condiotti, Roy Z Granit, Yuval Nevo, Yaakov Fixler, Dorin Shreibman, Amit Zamir, Sharona Tornovsky-Babeay, Chunhua Dai, Benjamin Glaser, Alvin C Powers, A M James Shapiro, Mark A Magnuson, Yuval Dor, Ittai Ben-Porath. Nat Med.?2016 Apr;22(4):412-20. |