| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | IHC-P,WB-Tr |
| Brand: | Abnova |
| Reference: | PAB31051 |
| Product name: | FHIT polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against partial recombiant human FHIT. |
| Isotype: | IgG |
| Gene id: | 2272 |
| Gene name: | FHIT |
| Gene alias: | AP3Aase|FRA3B |
| Gene description: | fragile histidine triad gene |
| Immunogen: | Recombinant protein corresponding to human FHIT. |
| Immunogen sequence/protein sequence: | FRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVE |
| Protein accession: | P49789 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-50) Western Blot (1:100-250) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot (Cell lysate) analysis of (1) Negative control (vector only transfected HEK293T lysate), and (2) fHit over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells). |
| Applications: | IHC-P,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | High-resolution whole-genome analysis of skull base chordomas implicates FHIT loss in chordoma pathogenesis.Diaz RJ, Guduk M, Romagnuolo R, Smith CA, Northcott P, Shih D, Berisha F, Flanagan A, Munoz DG, Cusimano MD, Pamir MN, Rutka JT. Neoplasia. 2012 Sep;14(9):788-98. |