ACAA1 monoclonal antibody, clone CL2650 View larger

ACAA1 monoclonal antibody, clone CL2650

New product

455,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ACAA1 monoclonal antibody, clone CL2650

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P

More info about ACAA1 monoclonal antibody, clone CL2650

Brand: Abnova
Reference: MAB15764
Product name: ACAA1 monoclonal antibody, clone CL2650
Product description: Mouse monoclonal antibody raised against partial recombinant human ACAA1.
Clone: CL2650
Isotype: IgG1
Gene id: 30
Gene name: ACAA1
Gene alias: ACAA|PTHIO|THIO
Gene description: acetyl-Coenzyme A acyltransferase 1
Immunogen: Recombinant protein corresponding to human ACAA1.
Immunogen sequence/protein sequence: VLKDVNLRPEQLGDICVGNVLQPGAGAIMARIAQFLSDIPETVPLSTVNRQCSSGLQAVASIAGGIRNGSYDIGMACGVESMSLADRGNPGNITSRLMEKEKARDCLIPMGITSENVAERFGISREKQ
Protein accession: P09110
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: MAB15764-46-187-1.jpg
Application image note: Western Blot analysis of U-251 cell lysate with ACAA1 monoclonal antibody, clone CL2650 (Cat # MAB15764).
Applications: WB-Ce,IHC-P
Shipping condition: Dry Ice

Reviews

Buy ACAA1 monoclonal antibody, clone CL2650 now

Add to cart