PDIA3 monoclonal antibody, clone CL2452 View larger

PDIA3 monoclonal antibody, clone CL2452

New product

455,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PDIA3 monoclonal antibody, clone CL2452

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P

More info about PDIA3 monoclonal antibody, clone CL2452

Brand: Abnova
Reference: MAB15750
Product name: PDIA3 monoclonal antibody, clone CL2452
Product description: Mouse monoclonal antibody raised against partial recombinant human PDIA3.
Clone: CL2452
Isotype: IgG2b
Gene id: 2923
Gene name: PDIA3
Gene alias: ER60|ERp57|ERp60|ERp61|GRP57|GRP58|HsT17083|P58|PI-PLC
Gene description: protein disulfide isomerase family A, member 3
Immunogen: Recombinant protein corresponding to human PDIA3.
Immunogen sequence/protein sequence: PTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASVPLRTEEEFKKFISDKDASIVGFFDDSFSEAHSEFLKAASNLRDNYRFAHTNVESLVNEYDDNGEGIILFRPSHLTNKFEDK
Protein accession: P30101
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:5000-1:10000)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: MAB15750-46-187-1.jpg
Application image note: Western Blot analysis of U-251 MG cell lysate with PDIA3 monoclonal antibody, clone CL2452 (Cat # MAB15750).
Applications: WB-Ce,IHC-P
Shipping condition: Dry Ice

Reviews

Buy PDIA3 monoclonal antibody, clone CL2452 now

Add to cart