LY6K monoclonal antibody, clone CL2433 View larger

LY6K monoclonal antibody, clone CL2433

New product

455,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LY6K monoclonal antibody, clone CL2433

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,IHC-P

More info about LY6K monoclonal antibody, clone CL2433

Brand: Abnova
Reference: MAB15746
Product name: LY6K monoclonal antibody, clone CL2433
Product description: Mouse monoclonal antibody raised against partial recombinant human LY6K.
Clone: CL2433
Isotype: IgG1
Gene id: 54742
Gene name: LY6K
Gene alias: FLJ35226|HSJ001348
Gene description: lymphocyte antigen 6 complex, locus K
Immunogen: Recombinant protein corresponding to human LY6K.
Immunogen sequence/protein sequence: TDEGDNRVWCHVCERENTFECQNPRRCKWTEPYCVIAAVKIFPRFFMVAKQCSAGCAAMERPKPEEKRFLLEEPMPFFYLKCCKIRYCNLEGPPINSSVFKEYAG
Protein accession: Q17RY6
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: MAB15746-47-12-1.jpg
Application image note: Western Blot analysis of human testis tissue lysate with LY6K monoclonal antibody, clone CL2433 (Cat # MAB15746).
Applications: WB-Ti,IHC-P
Shipping condition: Dry Ice

Reviews

Buy LY6K monoclonal antibody, clone CL2433 now

Add to cart