MKI67IP monoclonal antibody, clone CL2237 View larger

MKI67IP monoclonal antibody, clone CL2237

New product

455,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MKI67IP monoclonal antibody, clone CL2237

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P

More info about MKI67IP monoclonal antibody, clone CL2237

Brand: Abnova
Reference: MAB15733
Product name: MKI67IP monoclonal antibody, clone CL2237
Product description: Mouse monoclonal antibody raised against partial recombinant human MKI67IP.
Clone: CL2237
Isotype: IgG1
Gene id: 84365
Gene name: MKI67IP
Gene alias: NIFK|Nopp34
Gene description: MKI67 (FHA domain) interacting nucleolar phosphoprotein
Immunogen: Recombinant protein corresponding to human MKI67IP.
Immunogen sequence/protein sequence: IDYDFPSLILQKTESISKTNRQTSTKGQVLRKKKKKVSGTLDTPEKTVDSQGPTPVCTPTFLERRKSQVAELNDDDKDDEI
Protein accession: Q9BYG3
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:2500-1:5000)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: MAB15733-46-187-1.jpg
Application image note: Western Blot analysis of U-251 MG cell lysate with MKI67IP monoclonal antibody, clone CL2237 (Cat # MAB15733).
Applications: WB-Ce,IHC-P
Shipping condition: Dry Ice

Reviews

Buy MKI67IP monoclonal antibody, clone CL2237 now

Add to cart