TP53 monoclonal antibody, clone CL2199 View larger

TP53 monoclonal antibody, clone CL2199

New product

455,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TP53 monoclonal antibody, clone CL2199

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,IF

More info about TP53 monoclonal antibody, clone CL2199

Brand: Abnova
Reference: MAB15729
Product name: TP53 monoclonal antibody, clone CL2199
Product description: Mouse monoclonal antibody raised against partial recombinant human TP53.
Clone: CL2199
Isotype: IgG1
Gene id: 7157
Gene name: TP53
Gene alias: FLJ92943|LFS1|TRP53|p53
Gene description: tumor protein p53
Immunogen: Recombinant protein corresponding to human TP53.
Immunogen sequence/protein sequence: KKGEPHHELPPGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPGGSRAHSSHLKSKKGQSTSR
Protein accession: P04637
Form: Liquid
Recommend dilutions: Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: MAB15729-49-4-1.jpg
Application image note: Immunofluorescent staining of A431 cells with TP53 monoclonal antibody, clone CL2199 (Cat # MAB15729) (Green) shows cell cycle dependent nuclear (without nucleoli). Microtubule and nuclear probes are visualized in red and blue respectively (where available).
Applications: WB-Ce,IHC-P,IF
Shipping condition: Dry Ice
Publications: Downregulation of the cancer susceptibility protein WRAP53β in epithelial ovarian cancer leads to defective DNA repair and poor clinical outcome.Hedstrom E, Pederiva C, Farnebo J, Nodin B, Jirstrom K, Brennan DJ, Farnebo M.
Cell Death Dis. 2015 Oct 1;6:e1892. doi: 10.1038/cddis.2015.250.

Reviews

Buy TP53 monoclonal antibody, clone CL2199 now

Add to cart