MYH6 monoclonal antibody, clone CL2155 View larger

MYH6 monoclonal antibody, clone CL2155

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MYH6 monoclonal antibody, clone CL2155

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,IHC-P

More info about MYH6 monoclonal antibody, clone CL2155

Brand: Abnova
Reference: MAB15727
Product name: MYH6 monoclonal antibody, clone CL2155
Product description: Mouse monoclonal antibody raised against partial recombinant human MYH6.
Clone: CL2155
Isotype: IgG1
Gene id: 4624
Gene name: MYH6
Gene alias: ASD3|MYHC|MYHCA|alpha-MHC
Gene description: myosin, heavy chain 6, cardiac muscle, alpha
Immunogen: Recombinant protein corresponding to human MYH6.
Immunogen sequence/protein sequence: QVEEDKVNSLSKSKVKLEQQVDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTQESIMDLENDKLQLEEKLKKKEFDINQQNSKIEDEQVLALQLQKKLKENQARIEELEEELEAERTARAKVEKLRSDLSRELEEISERLEEA
Protein accession: P13533
Form: Liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:5000-1:10000)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: MAB15727-47-43-1.jpg
Application image note: Western Blot analysis of human skeletal muscle tissue lysate with MYH6 monoclonal antibody, clone CL2155 (Cat # MAB15727).
Applications: WB-Ti,IHC-P
Shipping condition: Dry Ice

Reviews

Buy MYH6 monoclonal antibody, clone CL2155 now

Add to cart