| Brand | Abnova | 
| Product type | Primary antibodies | 
| Reactivity | Human,Mouse | 
| Host species | Mouse | 
| Applications | WB-Ce,IHC-P,IF | 
| Brand: | Abnova | 
| Reference: | MAB15713 | 
| Product name: | SOX2 monoclonal antibody, clone CL4716 | 
| Product description: | Mouse monoclonal antibody raised against partial recombinant human SOX2. | 
| Clone: | CL4716 | 
| Isotype: | IgG1 | 
| Gene id: | 6657 | 
| Gene name: | SOX2 | 
| Gene alias: | ANOP3|MCOPS3|MGC2413 | 
| Gene description: | SRY (sex determining region Y)-box 2 | 
| Immunogen: | Recombinant protein corresponding to human SOX2. | 
| Immunogen sequence/protein sequence: | GSYSMMQDQLGYPQHPGLNAHGAAQMQPMHRYDVSALQYNSMTSSQTYMNGSPTYSMSYSQQGTPGMALGSM | 
| Protein accession: | P48431 | 
| Form: | Liquid | 
| Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:1000-1:2500) Immunofluorescence (1-4 ug/mL) Western Blot (1:500-1:1000) The optimal working dilution should be determined by the end user.  | 
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). | 
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing.  | 
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. | 
| Product type: | Primary antibodies | 
| Host species: | Mouse | 
| Antigen species / target species: | Human | 
| Reactivity: | Human,Mouse | 
| Application image: | ![]()  | 
| Application image note: | Western Blot (Cell lysate) analysis of NTERA-2 cell lysate. | 
| Applications: | WB-Ce,IHC-P,IF | 
| Shipping condition: | Dry Ice |